Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein E6 (E6)

This Recombinant Mouse Protein E6 (E6) spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D9D5K2

Expression Region

1-140aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus papillomavirus type 1

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEIGKGYTLEEVLRYSNKDVVDFHLSCAFCSTTMDHNEKARFIQAKLKCVVRDFAFKGACIVCRRQLACKEKLLHTRVTGEADLVECMAGKNIVFVTVRCVTCLALLTASEKLDAKACGLPFHLVRHMWRGYCGFCKPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FABP3/H-FABP Antibody (FABP3/8343R) [Janelia Fluor 646]
NBP3-21013JF646 0.1 mL

Rabbit Monoclonal FABP3/H-FABP Antibody (FABP3/8343R) [Janelia Fluor 646]

Sign In for Pricing
View Details
Lentiviral mouse Anapc13 shRNA (UAS) - Lentiviral mouse Anapc13 shRNA (UAS) (25)
GTR15224921 1 Vial

Lentiviral mouse Anapc13 shRNA (UAS) - Lentiviral mouse Anapc13 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Human Phosphodiesterase 4A/PDE4A CF
7767-PE-010 10 µg

Recombinant Human Phosphodiesterase 4A/PDE4A CF

Sign In for Pricing
View Details
CD37 Recombinant Antibody [G28-1]
OAAV01067-200UG 200 µg

CD37 Recombinant Antibody [G28-1]

Sign In for Pricing
View Details
SPECA Rabbit Polyclonal Antibody (HRP)
orb479914 100 µL

SPECA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Secretagogin (SCGN) ELISA Kit
orb1656041-01 48 Tests

Mouse Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details