Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein DVR-1 (dvr1)

This Recombinant Danio rerio Protein DVR-1 (dvr1) spans the amino acid sequence from region 241-355aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dvr-1, vg1

UniProt

P35621

Expression Region

241-355aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SASYYLPVTPSNVCKPRRLYIDFKDVGWQDWIIAPQGYLANYCHGECPFPLSESLNGTNHAILQTLVHSFDPKGTPQPCCVPIKLSPISMLYYDNNDNVVLRHYEDMVVDECGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ces1e activation kit by CRISPRa
GA201294 1 Kit

Mouse Ces1e activation kit by CRISPRa

Sign In for Pricing
View Details
TAF10 Polyclonal Antibody
E-AB-13719-01 20 µL

TAF10 Polyclonal Antibody

Sign In for Pricing
View Details
TAF10 Polyclonal Antibody
E-AB-13719-02 60 µL

TAF10 Polyclonal Antibody

Sign In for Pricing
View Details
TAF10 Polyclonal Antibody
E-AB-13719-03 120 µL

TAF10 Polyclonal Antibody

Sign In for Pricing
View Details
TAF10 Polyclonal Antibody
E-AB-13719-04 200 µL

TAF10 Polyclonal Antibody

Sign In for Pricing
View Details
FANCA (NM_001018112) Human Over-expression Lysate
LY422658 100 µg

FANCA (NM_001018112) Human Over-expression Lysate

Sign In for Pricing
View Details