Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2), partial

This Recombinant Influenza A virus Matrix protein 2 (M2), partial spans the amino acid sequence from region 1-22aa&44-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A088G224

Expression Region

1-22aa&44-97aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Influenza A virus (A/New York/WC-LVD-14-006/2014 (H1N1) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETPTRSEWECRCSGSGGGGSGGGGSDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm1110 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21719114 3x 1.0 µg

Gm1110 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Ceacam12 Protein Vector (Mouse) (pPM-C-HA)
PV164408 500 ng

Ceacam12 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Tceb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7098905 3x 1.0 µg

Tceb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
EIF5A/eIF5A2 Polyclonal Antibody
RA24498-01 50 µL

EIF5A/eIF5A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF5A/eIF5A2 Polyclonal Antibody
RA24498-02 100 µL

EIF5A/eIF5A2 Polyclonal Antibody

Sign In for Pricing
View Details
GMEB1 Human Pre-designed siRNA Set A
HY-RS05516 1 Set

GMEB1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details