Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD44 antigen (CD44), partial

This Recombinant Human CD44 antigen (CD44), partial spans the amino acid sequence from region 224-603aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDw44; Epican; Extracellular matrix receptor III; ECMR-III; GP90 lymphocyte homing/adhesion receptor; HUTCH-I; Heparan sulfate proteoglycan; Hermes antigen; Hyaluronate receptor; Phagocytic glycoprotein 1; PGP-1; Phagocytic glycoprotein I; PGP-I; CD antigen CD44

UniProt

P16070

Expression Region

224-603aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cd300lf Pre-designed siRNA Set A
SI202307A 1 Each

Rat Cd300lf Pre-designed siRNA Set A

Sign In for Pricing
View Details
6,8-Dimethylbenz[a]anthracene
010254 10 mg

6,8-Dimethylbenz[a]anthracene

Sign In for Pricing
View Details
APPBP1 (NAE1, NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid beta Precursor Protein-binding Protein 1, 59kD, Amyloid Protein-binding Protein 1, Proto-oncogene Protein 1, A-116A10.1, HPP1, Ula-1) (Biotin)
123448-Biotin 100 µL

APPBP1 (NAE1, NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid beta Precursor Protein-binding Protein 1, 59kD, Amyloid Protein-binding Protein 1, Proto-oncogene Protein 1, A-116A10.1, HPP1, Ula-1) (Biotin)

Sign In for Pricing
View Details
Anti-LILRB4 / ILT3 / CD85k Reference Antibody (U.Texas patent anti-LILRB4)
M04924-1 100 µg

Anti-LILRB4 / ILT3 / CD85k Reference Antibody (U.Texas patent anti-LILRB4)

Sign In for Pricing
View Details
Fatty Acid Binding Protein (FABP), Human
470716 100 µg

Fatty Acid Binding Protein (FABP), Human

Sign In for Pricing
View Details
Anti-human KIR3DL2 / CD158k (Lacutamab Biosimilar)
BIO0048SM-1mg 1 mg

Anti-human KIR3DL2 / CD158k (Lacutamab Biosimilar)

Sign In for Pricing
View Details