Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

This Recombinant Mouse Muellerian-inhibiting factor (Amh), partial spans the amino acid sequence from region 450-552aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS

UniProt

P27106

Expression Region

450-552aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CETN1 Protein, N-His
orb2968039-01 50 µg

Recombinant Human CETN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CETN1 Protein, N-His
orb2968039-02 100 µg

Recombinant Human CETN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CETN1 Protein, N-His
orb2968039-03 1 mg

Recombinant Human CETN1 Protein, N-His

Sign In for Pricing
View Details
G418 Sulfate Solution
400-113-020 20 mL

G418 Sulfate Solution

Sign In for Pricing
View Details
LN229 Cell Line
CL-0578 1x 10^6 Cells/Vial - 2 Vials

LN229 Cell Line

Sign In for Pricing
View Details
Abtb1 3'UTR GFP Stable Cell Line
TU151216 1.0 mL

Abtb1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details