Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

This Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial spans the amino acid sequence from region 24-455aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTL-II

UniProt

Q9UIR0

Expression Region

24-455aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O, O-Dimethyl Malathion
461394-01 100 mg

O, O-Dimethyl Malathion

Sign In for Pricing
View Details
O, O-Dimethyl Malathion
461394-02 500 mg

O, O-Dimethyl Malathion

Sign In for Pricing
View Details
Mouse ADD1 siRNA
abx906841-01 15 nmol

Mouse ADD1 siRNA

Sign In for Pricing
View Details
Mouse ADD1 siRNA
abx906841-02 30 nmol

Mouse ADD1 siRNA

Sign In for Pricing
View Details
Guinea Pig Protein dachsous homolog 2 ELISA kit
GTR10396137 96 Well

Guinea Pig Protein dachsous homolog 2 ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [HRP]
NBP3-20835H 0.1 mL

Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [HRP]

Sign In for Pricing
View Details