Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G (G)

This Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G (G) spans the amino acid sequence from region 1-257. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Attachment glycoprotein G; Membrane-bound glycoprotein; mG; Mature sG

UniProt

Q65706

Expression Region

1-257aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Bovine respiratory syncytial virus (strain 375) (BRS)

Field of Research

Infectious Disease & Virology; Respiratory Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNHTHHLKFKTGKRAWKPSKYFIVGLSCLYKFNLKSLVQTALSTLAMITLTSLVITAIIYISVGKSKAKPTSKPTIQQTQQPQNHTSPFFTENNYKSTHTSIQSTTLSQLINIDTTRGTTYGHSTDETQSRKIKSQSALPTTRKPPINPSESNPPENHQDHNNSQTLPYEPCSTCEGNLACLSLCQVGPGRAPSRAPTITLKKTPKPKTTKRPIKTTIHHRTSPEAKLQPKNNTAAPQQGILSSPENHTNQSTTQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSKH1 (NM_006742) Human Over-expression Lysate
LY402014 100 µg

PSKH1 (NM_006742) Human Over-expression Lysate

Sign In for Pricing
View Details
LGR5 Rabbit Polyclonal Antibody
AP12377PU-N 400 µL

LGR5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Srrm3 Mouse Gene Knockout Kit (CRISPR)
KN516737 1 Kit

Srrm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL
BNC740521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
T Cell Receptor (TCR) alpha/beta Mouse Monoclonal Antibody [Clone ID: IP26]
AM26003RP-N 100 Tests

T Cell Receptor (TCR) alpha/beta Mouse Monoclonal Antibody [Clone ID: IP26]

Sign In for Pricing
View Details
QuicKey Pro Porcine E3 (Estriol) ELISA Kit
E-OSEL-P0004-01 24 Tests

QuicKey Pro Porcine E3 (Estriol) ELISA Kit

Sign In for Pricing
View Details