Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C chemokine receptor type 7 (CCR7)

This Recombinant Human C-C chemokine receptor type 7 (CCR7) spans the amino acid sequence from region 25-378aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-C CKR-7; CC-CKR-7; CCR-7; BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197

UniProt

P32248

Expression Region

25-378aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF878 shRNA Plasmid
abx968740-01 150 µg

Human ZNF878 shRNA Plasmid

Sign In for Pricing
View Details
Human ZNF878 shRNA Plasmid
abx968740-02 300 µg

Human ZNF878 shRNA Plasmid

Sign In for Pricing
View Details
FLUO.D'HYD.450X52RL-T1-LL-P21 Pipe Markers for Acids & Bases
N000144 30 Pack (30 Marker (s) x 1 Roll)

FLUO.D'HYD.450X52RL-T1-LL-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
BacPAK6 sec+ Linearised DNA
101106 96 Reactions Kit

BacPAK6 sec+ Linearised DNA

Sign In for Pricing
View Details
MINPP1, NT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate 3-phosphatase, Inositol (1,3,4,5) -tetrakisphosphate 3-phosphatase) (MaxLight 490) discontinued
038440-ML490 100 µL

MINPP1, NT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate 3-phosphatase, Inositol (1,3,4,5) -tetrakisphosphate 3-phosphatase) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Porcine Peptidyl-Prolyl Cis-Trans Isomerase H (PPIH) ELISA Kit
MBS9927812-01 48 Well

Porcine Peptidyl-Prolyl Cis-Trans Isomerase H (PPIH) ELISA Kit

Sign In for Pricing
View Details