Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mammaglobin-B (SCGB2A1)

This Recombinant Human Mammaglobin-B (SCGB2A1) spans the amino acid sequence from region 19-95aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lacryglobin; Lipophilin-C; Mammaglobin-2; Secretoglobin family 2A member 1

UniProt

O75556

Expression Region

19-95aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(4-Bromophenyl)piperidin-2-one
TRC-B698503-500MG 500 mg

1-(4-Bromophenyl)piperidin-2-one

Sign In for Pricing
View Details
2-Chloro-6-hydroxypyridine
TRC-C585923-1G 1 g

2-Chloro-6-hydroxypyridine

Sign In for Pricing
View Details
FAM116A (DENND6A) Rabbit Polyclonal Antibody
TA360902 100 µL

FAM116A (DENND6A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Klf15 Mouse Gene Knockout Kit (CRISPR)
KN308828RB 1 Kit

Klf15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDAC4 Mouse Monoclonal Antibody [Clone ID: 7B2]
AM06461SU-N 100 µL

HDAC4 Mouse Monoclonal Antibody [Clone ID: 7B2]

Sign In for Pricing
View Details
RUNDC2B (NM_001012391) Human Over-expression Lysate
LC423333 20 µg

RUNDC2B (NM_001012391) Human Over-expression Lysate

Sign In for Pricing
View Details