Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mammaglobin-B (SCGB2A1)

This Recombinant Human Mammaglobin-B (SCGB2A1) spans the amino acid sequence from region 19-95aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lacryglobin; Lipophilin-C; Mammaglobin-2; Secretoglobin family 2A member 1

UniProt

O75556

Expression Region

19-95aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ThyroglobuLin (TG) (NM_003235) Human Recombinant Protein
TP701224-B 50 µg

ThyroglobuLin (TG) (NM_003235) Human Recombinant Protein

Sign In for Pricing
View Details
Human NPAS4 activation kit by CRISPRa
GA116949 1 Kit

Human NPAS4 activation kit by CRISPRa

Sign In for Pricing
View Details
RSK4 (RPS6KA6) (NM_014496) Human Over-expression Lysate
LY402340 100 µg

RSK4 (RPS6KA6) (NM_014496) Human Over-expression Lysate

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF568 conjugate, 0.1mg/mL
BNC681997-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VSIG1 Human qPCR Primer Pair (NM_182607)
HP219145 200 Reactions

VSIG1 Human qPCR Primer Pair (NM_182607)

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS501424 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details