Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allergin-1 (MILR1), partial

This Recombinant Human Allergin-1 (MILR1), partial spans the amino acid sequence from region 249-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergy inhibitory receptor 1; Mast cell antigen 32; MCA-32; Mast cell immunoglobulin-like receptor 1

UniProt

Q7Z6M3

Expression Region

249-343aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPKYKTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAC2 (TINCR) Mouse Monoclonal Antibody [Clone ID: OTI6C11]
TA810461S 30 µL

PLAC2 (TINCR) Mouse Monoclonal Antibody [Clone ID: OTI6C11]

Sign In for Pricing
View Details
ATTO 565 amine
orb3133030-01 50 mg

ATTO 565 amine

Sign In for Pricing
View Details
ATTO 565 amine
orb3133030-02 10 mg

ATTO 565 amine

Sign In for Pricing
View Details
HAND1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV680215 1.0 µg DNA

HAND1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
P120 (m) -PR
sc-36140-PR 10 µM - 20 µL

P120 (m) -PR

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS633332 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details