Recombinant Bovine Platelet-derived growth factor subunit B (PDGFB), partial
This Recombinant Bovine Platelet-derived growth factor subunit B (PDGFB), partial spans the amino acid sequence from region 82-190aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide
UniProt
B1H0W5
Expression Region
82-190aa
Tag
N-terminal 10xHis-DsbA-tagged
Source
E.coli
Origin
Bos taurus (Bovine)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVVARAVT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BMP4 Mouse Monoclonal Antibody [Clone ID: OTI1D1]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
GTR15146096 1 Vial
Lentiviral human OTOA shRNA (UAS) - Lentiviral human OTOA shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details RDR-EGLN1-Mu-01 96 Tests
Mouse Egl Nine Homolog 1 (EGLN1) ELISA Kit
Sign In for Pricing
View Details RDR-EGLN1-Mu-02 48 Tests
Mouse Egl Nine Homolog 1 (EGLN1) ELISA Kit
Sign In for Pricing
View Details 
ST62P0130 Box of 100
Box of 100 folded standard filter 73g/m², 130 mm
Sign In for Pricing
View Details