Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C chemokine receptor type 5 (CXCR5), partial

This Recombinant Human C-X-C chemokine receptor type 5 (CXCR5), partial spans the amino acid sequence from region 1-55aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CXC-R5; CXCR-5; Burkitt lymphoma receptor 1; Monocyte-derived receptor 15; MDR-15; CD antigen CD185

UniProt

P32302

Expression Region

1-55aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IGF2BP3 siRNA
abx920300-01 15 nmol

Human IGF2BP3 siRNA

Sign In for Pricing
View Details
Human IGF2BP3 siRNA
abx920300-02 30 nmol

Human IGF2BP3 siRNA

Sign In for Pricing
View Details
N- (4-Ethynylpyridin-2-yl) acetamide
VHC87640-01 50 mg

N- (4-Ethynylpyridin-2-yl) acetamide

Sign In for Pricing
View Details
N- (4-Ethynylpyridin-2-yl) acetamide
VHC87640-02 0.5 g

N- (4-Ethynylpyridin-2-yl) acetamide

Sign In for Pricing
View Details
DCP1B Protein Vector (Human) (pPM-C-His)
PV011784 500 ng

DCP1B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
hsa-miR-125b-5p Primers
MPH02122 150 µL / 10 µM

hsa-miR-125b-5p Primers

Sign In for Pricing
View Details