Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin (Prl)

This Recombinant Mouse Prolactin (Prl) spans the amino acid sequence from region 30-226aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRL

UniProt

P06879

Expression Region

30-226aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH (MUTYH) (NM_001048174) Human Tagged ORF Clone
RC201376 10 µg

MYH (MUTYH) (NM_001048174) Human Tagged ORF Clone

Sign In for Pricing
View Details
HRH/HR2025 ANALYTICAL COMB
IB56125 1 Each

HRH/HR2025 ANALYTICAL COMB

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial
MBS1306039-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial
MBS1306039-02 0.05 mg (Baculovirus)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial
MBS1306039-03 0.5 mg (Yeast)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial
MBS1306039-04 0.05 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 22 (WAKL22), partial

Sign In for Pricing
View Details