Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rap-2c (RAP2C)

This Recombinant Human Ras-related protein Rap-2c (RAP2C) spans the amino acid sequence from region 1-180aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9Y3L5

Expression Region

1-180aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI7D6]
CF805922 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

Sign In for Pricing
View Details
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF647 conjugate, 0.1mg/mL
BNC472982-100 1x 100 µL

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse CD51 Antibody[RMV-7]
E-AB-F1235D-01 50 Tests

PE Anti-Mouse CD51 Antibody[RMV-7]

Sign In for Pricing
View Details
PE Anti-Mouse CD51 Antibody[RMV-7]
E-AB-F1235D-02 100 Tests

PE Anti-Mouse CD51 Antibody[RMV-7]

Sign In for Pricing
View Details
PE Anti-Mouse CD51 Antibody[RMV-7]
E-AB-F1235D-03 2x 100 Tests

PE Anti-Mouse CD51 Antibody[RMV-7]

Sign In for Pricing
View Details
B3GNT6 (NM_138706) Human Recombinant Protein
TP314024L 1 mg

B3GNT6 (NM_138706) Human Recombinant Protein

Sign In for Pricing
View Details