Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rap-2c (RAP2C)

This Recombinant Human Ras-related protein Rap-2c (RAP2C) spans the amino acid sequence from region 1-180aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9Y3L5

Expression Region

1-180aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), 0.2mg/mL
BNUB1810-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), 0.2mg/mL

Sign In for Pricing
View Details
ZNF607 Human Gene Knockout Kit (CRISPR)
KN422778 1 Kit

ZNF607 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dithianon-d4
TRC-D356770-5MG 5 mg

Dithianon-d4

Sign In for Pricing
View Details
SLC17A2 Antibody
8C18869-AAT 50 µg

SLC17A2 Antibody

Sign In for Pricing
View Details
3’’’-Epi-Empagliflozin
TRC-E586000-25MG 25 mg

3’’’-Epi-Empagliflozin

Sign In for Pricing
View Details
Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein
TP321065L 1 mg

Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein

Sign In for Pricing
View Details