Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

This Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial spans the amino acid sequence from region 22-338aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-36 receptor; Interleukin-1 receptor-related protein 2; IL-1Rrp2; IL1R-rp2

UniProt

Q9ERS7

Expression Region

22-338aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Nucleoprotein Antibody
KC-452-01 50 μL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-452-02 100 µL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-452-03 1 mL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®503R Conjugate - Biotium Choice
P009-503R-500 1x 500 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®503R Conjugate - Biotium Choice

Sign In for Pricing
View Details
MYT1L Antibody (Biotin)
KB-3705-01 50 μL

MYT1L Antibody (Biotin)

Sign In for Pricing
View Details
MYT1L Antibody (Biotin)
KB-3705-02 100 µL

MYT1L Antibody (Biotin)

Sign In for Pricing
View Details