Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial

This Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial spans the amino acid sequence from region 1-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHD-4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein; Mi2-beta

UniProt

Q14839

Expression Region

1-239aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Ethylphenyl Sulfate Potassium Salt
TRC-E925865-250MG 250 mg

4-Ethylphenyl Sulfate Potassium Salt

Sign In for Pricing
View Details
MACROH2A1 (NM_001040158) Human Over-expression Lysate
LY421700 100 µg

MACROH2A1 (NM_001040158) Human Over-expression Lysate

Sign In for Pricing
View Details
Collagen XIX α1 Antibody
8C12224-AAT 50 µg

Collagen XIX α1 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgA,  5nm
GAF-002-5 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgA, 5nm

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-910
BULC-910 1 Unit

Ultrasonic Cleaner BULC-910

Sign In for Pricing
View Details
10X Fish Gelatin Blocking Agent
#22010 1x 100 mL

10X Fish Gelatin Blocking Agent

Sign In for Pricing
View Details