Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial

This Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial spans the amino acid sequence from region 1-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHD-4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein; Mi2-beta

UniProt

Q14839

Expression Region

1-239aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL
BNC880863-500 1x 500 µL

Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS640402 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS635039 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
BNC472711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GREB1L (NM_001142966) Human Over-expression Lysate
LC428308 20 µg

GREB1L (NM_001142966) Human Over-expression Lysate

Sign In for Pricing
View Details
YES1 Rabbit Monoclonal Antibody [Clone ID: 23GB4945]
TA425340 100 µL

YES1 Rabbit Monoclonal Antibody [Clone ID: 23GB4945]

Sign In for Pricing
View Details