Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pinctada fucata Mantle gene 8

This Recombinant Pinctada fucata Mantle gene 8 spans the amino acid sequence from region 22-223aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3YL58

Expression Region

22-223aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WLFGSSSSSSSWGSRYSSPSSFSTRWSRYSPSWSSSRYTPSWSSSRYTPSWSSSRYSPSWSSSRSRFSSSRSSFPHDIKSKSGLNSLYNSRVTKVETFERPIRGMGGIKHNGVVATTKDGGRWLIHKGIGYGKSSDTVVTNARHMSSQWKPAGAKSARPGTTIGGLVKAGLANKRWNPWDAKCWDATDGMMKKAGRRKRATC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-500 1x 500 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL
BNC680853-100 1x 100 µL

P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details