Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD39, Mouse (sf9, His)

The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD39 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd39-protein-mouse-his.html

Smiles

TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI

Molecular Formula

12495 (Gene_ID) P55772 (T38-I478) (Accession)

Molecular Weight

Approximately 51 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N2,9-Diacetylguanine-13C2,15N
TRC-D335002-2.5MG 2.5 mg

N2,9-Diacetylguanine-13C2,15N

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL
BNC740413-100 1x 100 µL

Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Ethyladamantane
TRC-E897110-500MG 500 mg

1-Ethyladamantane

Sign In for Pricing
View Details
Lin28 (LIN28A) Mouse Monoclonal Antibody [Clone ID: 55CT58.12.1]
AM11048PU-N 400 µL

Lin28 (LIN28A) Mouse Monoclonal Antibody [Clone ID: 55CT58.12.1]

Sign In for Pricing
View Details
Biotin Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound),
BAT-2108-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound),

Sign In for Pricing
View Details
LRRC3C (NM_001195545) Human Over-expression Lysate
LC434114 20 µg

LRRC3C (NM_001195545) Human Over-expression Lysate

Sign In for Pricing
View Details