Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Arginine ABC transporter permease protein ArtM (artM), partial

This Recombinant Shigella flexneri Arginine ABC transporter permease protein ArtM (artM), partial spans the amino acid sequence from region 101-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P0AE33

Expression Region

101-154aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAPTA, AM Ester
#50000 1x 25 mg

BAPTA, AM Ester

Sign In for Pricing
View Details
SERINC5 Human Gene Knockout Kit (CRISPR)
KN424636 1 Kit

SERINC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CEP72 Human Gene Knockout Kit (CRISPR)
KN401663 1 Kit

CEP72 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CASTOR1 (NM_001037666) Human Over-expression Lysate
LY421975 100 µg

CASTOR1 (NM_001037666) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB503941 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Sarcosine Ethyl Ester Hydrochloride
TRC-S140510-10G 10 g

Sarcosine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details