Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bos indicus x Bos taurus Kappa-casein, partial

This Recombinant Bos indicus x Bos taurus Kappa-casein, partial spans the amino acid sequence from region 71-163aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A4W2EWS5

Expression Region

71-163aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos indicus x Bos taurus (Hybrid cattle)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVEST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF710
orb2922902-01 20 µg

Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF710

Sign In for Pricing
View Details
Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF710
orb2922902-02 100 µg

Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF710

Sign In for Pricing
View Details
RARRES1 Antibody
KC-1738-01 50 μL

RARRES1 Antibody

Sign In for Pricing
View Details
RARRES1 Antibody
KC-1738-02 100 µL

RARRES1 Antibody

Sign In for Pricing
View Details
RARRES1 Antibody
KC-1738-03 1 mL

RARRES1 Antibody

Sign In for Pricing
View Details
Rab5 (RAB5A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D9]
TA812808AM 100 µL

Rab5 (RAB5A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D9]

Sign In for Pricing
View Details