Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Haptoglobin (HP), partial

This Recombinant Human Haptoglobin (HP), partial spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zonulin

UniProt

P00738

Expression Region

1-134aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctxn3 AAV siRNA Pooled Vector
17131164 1.0 µg

Ctxn3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Genorise® Recombinant Donkey PLA2G7
GR176015 5 mg

Genorise® Recombinant Donkey PLA2G7

Sign In for Pricing
View Details
TNFRSF12A Antibody
CSB-PA925623-01 50 μL

TNFRSF12A Antibody

Sign In for Pricing
View Details
TNFRSF12A Antibody
CSB-PA925623-02 100 µL

TNFRSF12A Antibody

Sign In for Pricing
View Details
Anti-RAP1B antibody
STJ25297 100 µl

Anti-RAP1B antibody

Sign In for Pricing
View Details
SERTAD2 Protein Lysate
OCOA10966-20UG 20 µg

SERTAD2 Protein Lysate

Sign In for Pricing
View Details