Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly [ADP-ribose] polymerase tankyrase-2 (TNKS2), partial

This Recombinant Human Poly [ADP-ribose] polymerase tankyrase-2 (TNKS2), partial spans the amino acid sequence from region 873-1161aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 6; ARTD6; Poly [ADP-ribose] polymerase 5B; Protein poly-ADP-ribosyltransferase tankyrase-2; TNKS-2; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; Tankyrase II; Tankyrase-2; TANK2; Tankyrase-like protein; Tankyrase-related protein

UniProt

Q9H2K2

Expression Region

873-1161aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(4-Bromobenzyl)-2-butyl-4-chloro-1H-imidazole-5-carboxyaldehyde
B680195 100 mg

N-(4-Bromobenzyl)-2-butyl-4-chloro-1H-imidazole-5-carboxyaldehyde

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG), partial
MBS7099606 Inquire

Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG), partial

Sign In for Pricing
View Details
Anti-Human METTL23 Antibody Fluoro550 Conjugated
DZ41142-Fluoro550 200 µL/Vial

Anti-Human METTL23 Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
TNIP1 Adenovirus (Human)
47234051 1.0 mL

TNIP1 Adenovirus (Human)

Sign In for Pricing
View Details
11beta,16alpha,17alpha,21-Tetrahydroxypregna-1,4-diene-3,20-dione-d5
MBS6054347-01 1 mg

11beta,16alpha,17alpha,21-Tetrahydroxypregna-1,4-diene-3,20-dione-d5

Sign In for Pricing
View Details
11beta,16alpha,17alpha,21-Tetrahydroxypregna-1,4-diene-3,20-dione-d5
MBS6054347-02 5x 1 mg

11beta,16alpha,17alpha,21-Tetrahydroxypregna-1,4-diene-3,20-dione-d5

Sign In for Pricing
View Details