Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei LPS-assembly protein lptD (lptD), partial

This Recombinant Shigella sonnei LPS-assembly protein lptD (lptD), partial spans the amino acid sequence from region 50-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3Z5V5

Expression Region

50-200aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella sonnei (strain Ss046)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal NKX3.1 Antibody (NKX3.1/4562R) [Janelia Fluor 549]
NBP3-08744JF549 100 µL

Rabbit Monoclonal NKX3.1 Antibody (NKX3.1/4562R) [Janelia Fluor 549]

Sign In for Pricing
View Details
CK7 (5D12) Antibody
252973 0.1 mL

CK7 (5D12) Antibody

Sign In for Pricing
View Details
Anti-RAD50 Polyclonal Antibody
TMAB-12039-01 50 μL

Anti-RAD50 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RAD50 Polyclonal Antibody
TMAB-12039-02 100 µL

Anti-RAD50 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RAD50 Polyclonal Antibody
TMAB-12039-03 200 µL

Anti-RAD50 Polyclonal Antibody

Sign In for Pricing
View Details
OSM Double Nickase Plasmid (m)
sc-422076-NIC 20 µg

OSM Double Nickase Plasmid (m)

Sign In for Pricing
View Details