Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleolar protein 3 (NOL3)

This Recombinant Human Nucleolar protein 3 (NOL3) spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptosis repressor with CARD; Muscle-enriched cytoplasmic protein; Myp; Nucleolar protein of 30 kDa; Nop30

UniProt

O60936

Expression Region

1-208aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deltarasin
A3358-50 50 mg

Deltarasin

Sign In for Pricing
View Details
Dlg2 (NM_022282) Rat Tagged ORF Clone
RR211485 10 µg

Dlg2 (NM_022282) Rat Tagged ORF Clone

Sign In for Pricing
View Details
INTS12 Over-expression Lysate Product
GWB-B43EF9 0.1 mg

INTS12 Over-expression Lysate Product

Sign In for Pricing
View Details
LHB Rabbit Polyclonal Antibody (BF594)
orb2555586 100 µL

LHB Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Lentiviral mouse Me2 shRNA (UAS) - Lentiviral mouse Me2 shRNA (UAS, iRFP) (100)
GTR15180483 1 Vial

Lentiviral mouse Me2 shRNA (UAS) - Lentiviral mouse Me2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Cat Spleen Neutrophils Isolation Kit
P2580 200 mL/Kit

Cat Spleen Neutrophils Isolation Kit

Sign In for Pricing
View Details