Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein boule-like (BOLL)

This Recombinant Human Protein boule-like (BOLL) spans the amino acid sequence from region 1-283aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8N9W6

Expression Region

1-283aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit
MBS7227495-01 48 Well

Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit
MBS7227495-02 96 Well

Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit
MBS7227495-03 5x 96 Well

Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit

Sign In for Pricing
View Details
Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit
MBS7227495-04 10x 96 Well

Bovine ATP-binding cassette sub-family G member 5 (ABCG5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Elongation of very long chain fatty acids protein 3 (ELOVL3), partial
MBS7101283 Inquire

Recombinant Human Elongation of very long chain fatty acids protein 3 (ELOVL3), partial

Sign In for Pricing
View Details
KRTAP4-6 Double Nickase Plasmid (m)
sc-427173-NIC 20 µg

KRTAP4-6 Double Nickase Plasmid (m)

Sign In for Pricing
View Details