Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein boule-like (BOLL)

This Recombinant Human Protein boule-like (BOLL) spans the amino acid sequence from region 1-283aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8N9W6

Expression Region

1-283aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fndc3b (NM_173182) Mouse Tagged ORF Clone Lentiviral Particle
MR211801L3V 200 µL

Fndc3b (NM_173182) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GLRB Antibody - N-terminal region
ARP34996_P050-25UL 25 µL

GLRB Antibody - N-terminal region

Sign In for Pricing
View Details
NUSAP1 (NM_001243143) Human Tagged ORF Clone
RC234062 10 µg

NUSAP1 (NM_001243143) Human Tagged ORF Clone

Sign In for Pricing
View Details
SB-414796
MBS5774508 Inquire

SB-414796

Sign In for Pricing
View Details
ENPP3 Protein Lysate
OCOA12823-20UG 20 µg

ENPP3 Protein Lysate

Sign In for Pricing
View Details
Tmem50b 3'UTR GFP Stable Cell Line
TU170770 1.0 mL

Tmem50b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details