Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Envelope glycoprotein L (gL)

This Recombinant Epstein-Barr virus Envelope glycoprotein L (gL) spans the amino acid sequence from region 23-137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL

UniProt

P03212

Expression Region

23-137aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTX3 Recombinant Protein
OPCD06535-200UG 200 µg

PTX3 Recombinant Protein

Sign In for Pricing
View Details
Cyp26b1 Antibody
orb859311 2 mg

Cyp26b1 Antibody

Sign In for Pricing
View Details
Fish Coagulation Factor III ELISA Kit
MBS016978 Inquire

Fish Coagulation Factor III ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Survivin Antibody
NB100-56168 0.05 mL

Rabbit Polyclonal Survivin Antibody

Sign In for Pricing
View Details
Anti-zebrafish Mlh1 Antibody (Biotine Conjugate)
DZ41058-Biotin 200 µL/Vial

Anti-zebrafish Mlh1 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
Desmoglein 1 Polyclonal Antibody
bs-6725R 100 µL

Desmoglein 1 Polyclonal Antibody

Sign In for Pricing
View Details