Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), partial

This Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), partial spans the amino acid sequence from region 277-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted modular calcium-binding protein 1; SMOC-1

UniProt

Q9H4F8

Expression Region

277-382aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Viviparous8 Rabbit Polyclonal Antibody (BF750)
orb2414552 100 µL

Viviparous8 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CDK3 AAV siRNA Pooled Vector
15703161 1.0 µg

CDK3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral mouse Ugt1a10 shRNA (UAS) - Lentiviral mouse Ugt1a10 shRNA (UAS, GFP) (100)
GTR15255285 1 Vial

Lentiviral mouse Ugt1a10 shRNA (UAS) - Lentiviral mouse Ugt1a10 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RPS6KB3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2014804 1.0 µg DNA

RPS6KB3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human hsa-miR-200a-5p miRNA Antagomir
abx885462-01 10 nmol

Human hsa-miR-200a-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-200a-5p miRNA Antagomir
abx885462-02 20 nmol

Human hsa-miR-200a-5p miRNA Antagomir

Sign In for Pricing
View Details