Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphorylated adapter RNA export protein (Phax)

This Recombinant Mouse Phosphorylated adapter RNA export protein (Phax) spans the amino acid sequence from region 2-385aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA U small nuclear RNA export adapter protein

UniProt

Q9JJT9

Expression Region

2-385aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iapp Mouse Gene Knockout Kit (CRISPR)
KN308061LP 1 Kit

Iapp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Birc3 activation kit by CRISPRa
GA200228 1 Kit

Mouse Birc3 activation kit by CRISPRa

Sign In for Pricing
View Details
MMP10 Antibody (Biotin)
KB-3687-01 50 μL

MMP10 Antibody (Biotin)

Sign In for Pricing
View Details
MMP10 Antibody (Biotin)
KB-3687-02 100 µL

MMP10 Antibody (Biotin)

Sign In for Pricing
View Details
MMP10 Antibody (Biotin)
KB-3687-03 1 mL

MMP10 Antibody (Biotin)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), CF568 conjugate, 0.1mg/mL
BNC683230-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details