Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Virulence sensor protein PhoQ (phoQ), partial

This Recombinant Shigella flexneri Virulence sensor protein PhoQ (phoQ), partial spans the amino acid sequence from region 216-486aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sensor histidine protein kinase/phosphatase PhoQ

UniProt

Q83RR1

Expression Region

216-486aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WSLRPIEALAKEVRELEEHNRELLNPATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSVSDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQHSAPKDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Keratin-associated protein 13-3, KRTAP13-3 ELISA KIT
ELI-28023h 96 Tests

Human Keratin-associated protein 13-3, KRTAP13-3 ELISA KIT

Sign In for Pricing
View Details
Flt3 Ligand Porcine
32-6360-5 5 µg

Flt3 Ligand Porcine

Sign In for Pricing
View Details
Contraceptive Tetrapeptide
orb2693047-01 5 mg

Contraceptive Tetrapeptide

Sign In for Pricing
View Details
Contraceptive Tetrapeptide
orb2693047-02 10 mg

Contraceptive Tetrapeptide

Sign In for Pricing
View Details
Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10
orb3143050-01 10 mg

Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10

Sign In for Pricing
View Details
Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10
orb3143050-02 50 mg

Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10

Sign In for Pricing
View Details