Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neurotrimin (Ntm)

This Recombinant Mouse Neurotrimin (Ntm) spans the amino acid sequence from region 34-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99PJ0

Expression Region

34-321aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVENRPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss52 Mouse Gene Knockout Kit (CRISPR)
KN514051 1 Kit

Prss52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C18 Ceramide
TRC-C263050-5MG 5 mg

C18 Ceramide

Sign In for Pricing
View Details
CD38 Human Gene Knockout Kit (CRISPR)
KN203179RB 1 Kit

CD38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ML345
TRC-M425355-2.5MG 2.5 mg

ML345

Sign In for Pricing
View Details
Abcg4 Mouse Gene Knockout Kit (CRISPR)
KN500642 1 Kit

Abcg4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eotaxin 3 (CCL26) (NM_006072) Human Recombinant Protein
TP720095M 50 µg

Eotaxin 3 (CCL26) (NM_006072) Human Recombinant Protein

Sign In for Pricing
View Details