Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neurotrimin (Ntm)

This Recombinant Mouse Neurotrimin (Ntm) spans the amino acid sequence from region 34-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99PJ0

Expression Region

34-321aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVENRPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS705430 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
EIF4G1 pSer1232 Rabbit Polyclonal Antibody
AP08034PU-S 50 µL

EIF4G1 pSer1232 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM28 (NM_001166135) Human Over-expression Lysate
LC431533 20 µg

RBM28 (NM_001166135) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR560792 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559457 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Polystyrene A FP
HA50056007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details