Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Outer membrane protein assembly factor BamA (bamA), partial

This Recombinant Shigella flexneri Outer membrane protein assembly factor BamA (bamA), partial spans the amino acid sequence from region 24-421aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A943

Expression Region

24-421aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prestained protein ladder, 10-180kDa
PPLB180K101A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Prestained protein ladder, 10-180kDa

Sign In for Pricing
View Details
Rho (2S17) Rabbit Monoclonal Antibody
E28M4707 100 µL

Rho (2S17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UGDH Polyclonal Antibody, PE Conjugated
bs-6715R-PE 100 µL

UGDH Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
NEIL1 Rabbit Polyclonal Antibody (APC)
orb998713 100 µL

NEIL1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DSPE-PEG-RGD,MW:2000
MPL0123K Each

DSPE-PEG-RGD,MW:2000

Sign In for Pricing
View Details
Rabbit Polyclonal TIMM10 Antibody [Janelia Fluor 585]
NBP3-21445JF585 0.1 mL

Rabbit Polyclonal TIMM10 Antibody [Janelia Fluor 585]

Sign In for Pricing
View Details