Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Outer membrane protein assembly factor BamA (bamA), partial

This Recombinant Shigella flexneri Outer membrane protein assembly factor BamA (bamA), partial spans the amino acid sequence from region 24-421aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A943

Expression Region

24-421aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Oxo-5- (3-{[ (tetrahydro-2-furanylmethyl) amino]-carbonyl}anilino) pentanoic acid
sc-319009 500 mg

5-Oxo-5- (3-{[ (tetrahydro-2-furanylmethyl) amino]-carbonyl}anilino) pentanoic acid

Sign In for Pricing
View Details
Human Follicle Stimulating Hormone Recombinant
90138-B 10 µg

Human Follicle Stimulating Hormone Recombinant

Sign In for Pricing
View Details
Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody
FY-AB37507-01 1 mL

Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody
FY-AB37507-02 100 µL

Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody
FY-AB37507-03 200 µL

Anti-Tar Dna Binding Protein 43Kda (TDP43) Monoclonal antibody

Sign In for Pricing
View Details
2- (N-Benzylamino) -4-pyrrolidinopyridine
414319-01 25 mg

2- (N-Benzylamino) -4-pyrrolidinopyridine

Sign In for Pricing
View Details