Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial

This Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial spans the amino acid sequence from region 95-161aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Diacylglycerol pyrophosphate phosphatase; DGPP phosphatase; Phosphatidate phosphatase; Undecaprenyl pyrophosphate phosphatase; Undecaprenyl-diphosphatase

UniProt

P0A926

Expression Region

95-161aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Fatty Acid-Binding Protein 3/FABP3/H-FABP (N-6His)
C135-1mg 1 mg

Recombinant Human Fatty Acid-Binding Protein 3/FABP3/H-FABP (N-6His)

Sign In for Pricing
View Details
APAF1 Antibody
MBS9603808-01 0.1 mL

APAF1 Antibody

Sign In for Pricing
View Details
APAF1 Antibody
MBS9603808-02 0.2 mL

APAF1 Antibody

Sign In for Pricing
View Details
APAF1 Antibody
MBS9603808-03 5x 0.2 mL

APAF1 Antibody

Sign In for Pricing
View Details
DCAF7 polyclonal antibody
orb641332-01 50 μL

DCAF7 polyclonal antibody

Sign In for Pricing
View Details
DCAF7 polyclonal antibody
orb641332-02 100 µL

DCAF7 polyclonal antibody

Sign In for Pricing
View Details