Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmo salar Prolactin (prl)

This Recombinant Salmo salar Prolactin (prl) spans the amino acid sequence from region 24-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRL

UniProt

P48096

Expression Region

24-210aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Salmo salar (Atlantic salmon)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]
CF808964 100 µg

PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB531359 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-4265-01 50 μL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-4265-02 100 µL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-4265-03 1 mL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
EIF5B Antibody
8C15728-AAT 50 µg

EIF5B Antibody

Sign In for Pricing
View Details