Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmo salar Prolactin (prl)

This Recombinant Salmo salar Prolactin (prl) spans the amino acid sequence from region 24-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRL

UniProt

P48096

Expression Region

24-210aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Salmo salar (Atlantic salmon)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srpx Mouse Gene Knockout Kit (CRISPR)
KN516731 1 Kit

Srpx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639015 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
PROCR (NM_006404) Human Recombinant Protein
TP761291 50 µg

PROCR (NM_006404) Human Recombinant Protein

Sign In for Pricing
View Details
IGSF1 (C-term) Rabbit Polyclonal Antibody
AP52175PU-N 400 µL

IGSF1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AM4-66
#70050 1x 1 mg

AM4-66

Sign In for Pricing
View Details
Recombinant Human CD30 Protein (Fc Tag)
PDMH100233-01 20 µg

Recombinant Human CD30 Protein (Fc Tag)

Sign In for Pricing
View Details