Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Flagellar L-ring protein (flgH)

This Recombinant Shigella sonnei Flagellar L-ring protein (flgH) spans the amino acid sequence from region 22-232aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basal body L-ring protein

UniProt

Q3Z338

Expression Region

22-232aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella sonnei (strain Ss046)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CAWIPSTPLVQGATSAQPVPGPTPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC16B CRISPRa sgRNA lentivector (set of three targets)(Mouse)
27625124 3x 1.0µg DNA

LRRC16B CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
RN3L1, CT (RRN3-like protein 1) (MaxLight 550)
MBS6342375-01 0.1 mL

RN3L1, CT (RRN3-like protein 1) (MaxLight 550)

Sign In for Pricing
View Details
RN3L1, CT (RRN3-like protein 1) (MaxLight 550)
MBS6342375-02 5x 0.1 mL

RN3L1, CT (RRN3-like protein 1) (MaxLight 550)

Sign In for Pricing
View Details
RASSF4 Antibody
abx241266-01 50 µL

RASSF4 Antibody

Sign In for Pricing
View Details
RASSF4 Antibody
abx241266-02 100 µL

RASSF4 Antibody

Sign In for Pricing
View Details
4- (2-Cyclohexylacetamido) cyclohexane-1-carboxylic acid
JXB26690-01 250 mg

4- (2-Cyclohexylacetamido) cyclohexane-1-carboxylic acid

Sign In for Pricing
View Details