Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase

This Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase spans the amino acid sequence from region 1-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Xylanase;1,4-beta-D-xylan xylanohydrolase

UniProt

P48793

Expression Region

1-190aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Trichoderma harzianum (Hypocrea lixii)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTIGPGTGYSNGYYYSYWNDGHAGVTYTNGGGGSFTVNWSNSGNFVAGKGWQPGTKNKVINFSGSYNPNGNSYLSIYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWASHGLTLGTMDYQIVAVEGYFSSGSASITVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
AP71522-01 20 µg

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Sign In for Pricing
View Details
Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
AP71522-02 100 µg

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Sign In for Pricing
View Details
Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
AP71522-03 1 mg

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Sign In for Pricing
View Details
Duck Aryl-Hydrocarbon Receptor Nuclear Translocator 3 ELISA Kit
MBS053000 Inquire

Duck Aryl-Hydrocarbon Receptor Nuclear Translocator 3 ELISA Kit

Sign In for Pricing
View Details
L-(+)-Valinol
RM9072-1G 1 unit

L-(+)-Valinol

Sign In for Pricing
View Details
FOXF1, NT (FOXF1, FKHL5, FREAC1, Forkhead box protein F1, Forkhead-related activator 1, Forkhead-related protein FKHL5, Forkhead-related transcription factor 1) (APC)
MBS6299774-01 0.2 mL

FOXF1, NT (FOXF1, FKHL5, FREAC1, Forkhead box protein F1, Forkhead-related activator 1, Forkhead-related protein FKHL5, Forkhead-related transcription factor 1) (APC)

Sign In for Pricing
View Details