Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)

This Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5) spans the amino acid sequence from region 1-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SSB; Gene product 5; gp5; Protein p5

UniProt

Q38504

Expression Region

1-124aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus phage phi29 (Bacteriophage phi-29)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MENTNIVKATFDTETLEGQIKIFNAQTGGGQSFKNLPDGTIIEANAIAQYKQVSDTYGDAKEETVTTIFAADGSLYSAISKTVAEAASDLIDLVTRHKLETFKVKVVQGTSSKGNVFFSLQLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP7 Protein Vector (Mouse) (pPM-C-His)
PV227725 500 ng

SENP7 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CYP2D6 Recombinant Antibody, APC Conjugated
bsm-61641R-APC-TR 20 µL

CYP2D6 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [Alexa Fluor 532]
NBP3-24073AF532 0.1 mL

Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [Alexa Fluor 532]

Sign In for Pricing
View Details
Mouse Map4 Pre-designed siRNA Set B
SI108123B 1 Each

Mouse Map4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GCLC, ID (GCLC, GLCL, GLCLC, Glutamate-cysteine ligase catalytic subunit, GCS heavy chain, Gamma-ECS, Gamma-glutamylcysteine synthetase)
MBS643438-01 0.2 mL

GCLC, ID (GCLC, GLCL, GLCLC, Glutamate-cysteine ligase catalytic subunit, GCS heavy chain, Gamma-ECS, Gamma-glutamylcysteine synthetase)

Sign In for Pricing
View Details
GCLC, ID (GCLC, GLCL, GLCLC, Glutamate-cysteine ligase catalytic subunit, GCS heavy chain, Gamma-ECS, Gamma-glutamylcysteine synthetase)
MBS643438-02 5x 0.2 mL

GCLC, ID (GCLC, GLCL, GLCLC, Glutamate-cysteine ligase catalytic subunit, GCS heavy chain, Gamma-ECS, Gamma-glutamylcysteine synthetase)

Sign In for Pricing
View Details