Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial

This Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial spans the amino acid sequence from region 31-87aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Exophilin-7

UniProt

Q99N80

Expression Region

31-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLDLSFLTEEEQEAISDVLKRDAHLRQLEEGRVSKLRASLEDPWQLKILTGDWFQEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit
ELK6060-01 48 Tests

Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit
ELK6060-02 96 Tests

Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit
ELK6060-03 5x 96 Tests

Mouse PPP3R1 (Protein Phosphatase 3, Regulatory Subunit 1) ELISA Kit

Sign In for Pricing
View Details
N-cyclopentyl-N-cyclopropylamine
sc-355593 1 g

N-cyclopentyl-N-cyclopropylamine

Sign In for Pricing
View Details
RRAGC Rabbit pAb
E45R27431N-50 50 µL

RRAGC Rabbit pAb

Sign In for Pricing
View Details
14-3-3 eta Mouse Monoclonal Antibody (1G2)
E12-821 100 µg -100 µL

14-3-3 eta Mouse Monoclonal Antibody (1G2)

Sign In for Pricing
View Details