Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial

This Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial spans the amino acid sequence from region 31-87aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Exophilin-7

UniProt

Q99N80

Expression Region

31-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLDLSFLTEEEQEAISDVLKRDAHLRQLEEGRVSKLRASLEDPWQLKILTGDWFQEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1561778 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6446905 3x 1.0 µg

RGD1561778 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-DNA-RNA Hybrid Antibody (8A792)
TMAB-05246-01 50 μL

Anti-DNA-RNA Hybrid Antibody (8A792)

Sign In for Pricing
View Details
Anti-DNA-RNA Hybrid Antibody (8A792)
TMAB-05246-02 100 µL

Anti-DNA-RNA Hybrid Antibody (8A792)

Sign In for Pricing
View Details
Human PR domain zinc finger protein 13,PRDM13 ELISA KIT
ELI-45436h 96 Tests

Human PR domain zinc finger protein 13,PRDM13 ELISA KIT

Sign In for Pricing
View Details
Netrin 1 Polyclonal Antibody, PE Conjugated
bs-1858R-PE-01 20 µL

Netrin 1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Netrin 1 Polyclonal Antibody, PE Conjugated
bs-1858R-PE-02 100 µL

Netrin 1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details