Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein OPG154 (OPG154), Biotinylated

This Recombinant Vaccinia virus Protein OPG154 (OPG154), Biotinylated spans the amino acid sequence from region 1-110aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P11258

Expression Region

1-110aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDC2 (NM_014460) Human Tagged Lenti ORF Clone
RC208989L3 10 µg

CSDC2 (NM_014460) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CheKine Micro Creatine Kinase (CK) Activity Assay Kit
orb3148139-01 48 Tests

CheKine Micro Creatine Kinase (CK) Activity Assay Kit

Sign In for Pricing
View Details
CheKine Micro Creatine Kinase (CK) Activity Assay Kit
orb3148139-02 96 Tests

CheKine Micro Creatine Kinase (CK) Activity Assay Kit

Sign In for Pricing
View Details
PDE1B Antibody BIOTIN-Conjugated
MBS543438-01 0.1 mg

PDE1B Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
PDE1B Antibody BIOTIN-Conjugated
MBS543438-02 5x 0.1 mg

PDE1B Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Ppp1r42 (NM_027033) Mouse Tagged Lenti ORF Clone
MR223570L3 10 µg

Ppp1r42 (NM_027033) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details