Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit alpha (Hba)

This Recombinant Mouse Hemoglobin subunit alpha (Hba) spans the amino acid sequence from region 2-142aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-globin; Hemoglobin alpha chain

UniProt

P01942

Expression Region

2-142aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMIM8 shRNA (UAS) - Lentiviral human SMIM8 shRNA (UAS) (25)
GTR15331316 1 Vial

Lentiviral human SMIM8 shRNA (UAS) - Lentiviral human SMIM8 shRNA (UAS) (25)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 121 (VEGF121) BioAssayTM ELISA Kit (Mouse)
517751 96 Tests

Vascular Endothelial Growth Factor 121 (VEGF121) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
TMC353121 2mg
A11585-2 2 mg

TMC353121 2mg

Sign In for Pricing
View Details
SCNN1B Rabbit pAb
E47R4252 100 µL

SCNN1B Rabbit pAb

Sign In for Pricing
View Details
FAT2 Protein Vector (Rat) (pPB-N-His)
PV267855 500 ng

FAT2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
JARID2 Rabbit mAb (AMR12027N)
AMR12027N-01 50 µL

JARID2 Rabbit mAb (AMR12027N)

Sign In for Pricing
View Details