Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis RNA-binding protein YbxF (rulS)

This Recombinant Bacillus subtilis RNA-binding protein YbxF (rulS) spans the amino acid sequence from region 1-82aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P46350

Expression Region

1-82aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561562 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
6-Oxo DL-Norleucine, Formate Salt
TRC-O870140-2.5MG 2.5 mg

6-Oxo DL-Norleucine, Formate Salt

Sign In for Pricing
View Details
SLC8A3 Human Gene Knockout Kit (CRISPR)
KN419062 1 Kit

SLC8A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF640R conjugate, 0.1mg/mL
BNC403059-500 1x 500 µL

Cyclin B2 (X29.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL
BNC400867-500 1x 500 µL

Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M4 (CHRM4) (NM_000741) Human Over-expression Lysate
LY400245 100 µg

Muscarinic Acetylcholine Receptor M4 (CHRM4) (NM_000741) Human Over-expression Lysate

Sign In for Pricing
View Details