Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2-microglobulin (B2M)

This Recombinant Cat Beta-2-microglobulin (B2M) spans the amino acid sequence from region 21-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5MGS7

Expression Region

21-118aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACLY Antibody
orb1557577-01 50 μL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
orb1557577-02 100 µL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
orb1557577-03 200 µL

ACLY Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 RBD (B.1.617.2) Protein, C-His
EVV00312 100 μg

Recombinant SARS-CoV-2 RBD (B.1.617.2) Protein, C-His

Sign In for Pricing
View Details
MCM2 3'UTR Luciferase Stable Cell Line
TU013121 1.0 mL

MCM2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PMP2 discontinued
393190 200 µL

PMP2 discontinued

Sign In for Pricing
View Details