Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

This Recombinant Human Bromodomain-containing protein 4 (BRD4), partial spans the amino acid sequence from region 49-170aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HUNK1

UniProt

O60885

Expression Region

49-170aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK6 Rabbit Monoclonal Antibody
E10G22697 100 µL

CDK6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TDP43 Rabbit mAb
E60M3659 100 µL

TDP43 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal ASAM Antibody [DyLight 755]
NBP2-98300IR 0.1 mL

Rabbit Polyclonal ASAM Antibody [DyLight 755]

Sign In for Pricing
View Details
GFP hsa-mir-1193 AAV miRNA Vector
Amh1003800 500 ng

GFP hsa-mir-1193 AAV miRNA Vector

Sign In for Pricing
View Details
Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Polyclonal Antibody
MBS2032866-01 0.1 mL

Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Polyclonal Antibody

Sign In for Pricing
View Details
Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Polyclonal Antibody
MBS2032866-02 0.2 mL

Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Polyclonal Antibody

Sign In for Pricing
View Details